PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_15897A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 243aa    MW: 28589.7 Da    PI: 6.929
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_15897AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.21.6e-28113163252
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ek++++e +s+yF++pi++AA+eL+v+lT+LK++CR++GI+RWPhRk+ksl
  Oropetium_20150105_15897A 113 EKTLTFELVSQYFYMPITQAARELDVGLTLLKKRCRELGIPRWPHRKMKSL 163
                                899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151918.00798183IPR003035RWP-RK domain
PfamPF020426.4E-22115163IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MEAKQEDSWW PYWTNAWPDN YLLEEEALLS DLSLQSLHFQ PSSYSAITPS NVLQERICIV  60
RAECIVLRGT DELDNIFKDD VLRHWDEMEQ VDTKIDERQN GLSPLYYRED KEEKTLTFEL  120
VSQYFYMPIT QAARELDVGL TLLKKRCREL GIPRWPHRKM KSLQTLINNV QVLQEAGKAT  180
GEGQLRAMVE MLQQEKQLLE KRPHVQLEEK TKRLRQACFK ANYKKRRLLA LETGQASRIQ  240
KY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0035091e-32AP003509.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0525F01.
GenBankAP0035691e-32AP003569.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0425F05.
GenBankAP0149621e-32AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-32CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966836.11e-110PREDICTED: protein RKD2
SwissprotQ9M9U93e-45RKD1_ARATH; Protein RKD1
TrEMBLK3Y2531e-110K3Y253_SETIT; Uncharacterized protein
STRINGSi008273m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP45903365
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-46RWP-RK domain-containing protein